(data stored in ACNUC30630 zone)

EMBL: CP001606.PE362

CP001606.PE362       Location/Qualifiers
FT   CDS             complement(462101..463192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0377"
FT                   /product="Rok family repressor"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47327"
FT                   /protein_id="ACS47327.1"
FT                   /translation="MESTTVKRHNRELILRELFAAPSMTKRQIADATRLSMPTITENLR
FT                   ELAADGLIVPAEARASTGGRKAQTWQFNARHRTAIGVALRPTEVVCMAVDLRGNVIAEH
FT                   KVTMARRNDNAYYERAAHTISTFAQSLPSPIGVCFALPSSAARHCICVAEDWNAATESY
FT                   QGISRILTLPCSRIARNVAYATVELHNHPLLRNAVCLYLGEYINSAIVMDGVAREGNLE
FT                   HMQLDASGDICRCGSRGCLEVLCSSRQLTEEGESLPGFFGVLEQGERNHHVRMDRWLGS
FT                   LAHAVNNIRTFVPADVILCGPIADYLDDSEIAQLERLTTCAEHVNPSARNPQVMRGCCV
FT                   EYQDAVGAAQSLIPASHDGIPSD"
     MESTTVKRHN RELILRELFA APSMTKRQIA DATRLSMPTI TENLRELAAD GLIVPAEARA        60
     STGGRKAQTW QFNARHRTAI GVALRPTEVV CMAVDLRGNV IAEHKVTMAR RNDNAYYERA       120
     AHTISTFAQS LPSPIGVCFA LPSSAARHCI CVAEDWNAAT ESYQGISRIL TLPCSRIARN       180
     VAYATVELHN HPLLRNAVCL YLGEYINSAI VMDGVAREGN LEHMQLDASG DICRCGSRGC       240
     LEVLCSSRQL TEEGESLPGF FGVLEQGERN HHVRMDRWLG SLAHAVNNIR TFVPADVILC       300
     GPIADYLDDS EIAQLERLTT CAEHVNPSAR NPQVMRGCCV EYQDAVGAAQ SLIPASHDGI       360
     PSD                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page