(data stored in ACNUC30630 zone)

EMBL: CP001606.PE38

CP001606.PE38        Location/Qualifiers
FT   CDS             43526..43639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47003"
FT                   /protein_id="ACS47003.1"
FT                   /translation="MNGVFAVGHKIGKIVGDPVYSECSAIFAQFGDEIMPE"
     MNGVFAVGHK IGKIVGDPVY SECSAIFAQF GDEIMPE                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page