(data stored in ACNUC30630 zone)

EMBL: CP001606.PE384

CP001606.PE384       Location/Qualifiers
FT   CDS             477123..477827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0399"
FT                   /product="30S ribosomal protein S5"
FT                   /note="COG0098 Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47349"
FT                   /protein_id="ACS47349.1"
FT                   /translation="MAEETQNTQATAESSNNDERRGRRNNRGGEGRRGDRRGRREDNHE
FT                   NEMLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQLDA
FT                   KKHLFNVPRIRGTVTHPVTGHDHAGTVMLRPAAPGTGVIAGSAVRAVMECAGITDILTK
FT                   SMGSATAVNVVRATVDALKQLEEPEEIAARRGLSVQEVAPDQLLRERAAGIAEARKARE
FT                   EAKAEAAAKDGE"
     MAEETQNTQA TAESSNNDER RGRRNNRGGE GRRGDRRGRR EDNHENEMLD RVVTINRVSK        60
     THKGGRTFSF AALVVVGDGN GTVGVGYGKS REVPAAIAKG QLDAKKHLFN VPRIRGTVTH       120
     PVTGHDHAGT VMLRPAAPGT GVIAGSAVRA VMECAGITDI LTKSMGSATA VNVVRATVDA       180
     LKQLEEPEEI AARRGLSVQE VAPDQLLRER AAGIAEARKA REEAKAEAAA KDGE             234
//

If you have problems or comments...

PBIL Back to PBIL home page