(data stored in ACNUC30630 zone)

EMBL: CP001606.PE4

CP001606.PE4         Location/Qualifiers
FT   CDS             5083..5586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0004"
FT                   /product="hypothetical protein"
FT                   /note="COG5512 Zn-ribbon-containing, possibly RNA-binding
FT                   protein and truncated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46969"
FT                   /protein_id="ACS46969.1"
FT                   /translation="MSEPPIAVTLKLDERALPAEEFEHVSARAGLIAERRVKREEALEN
FT                   FGKPGRDEVAFGSLFAGIAKRAGWVPHMKLAQLRHDWASIVGDVIARNTWVGAIDNGVL
FT                   TIHAKSPSWTTQLTFMLPELREKVLERLNGLDIRDIRVTGPQAHGPATRRKQYVRQNMH
FT                   YRPQ"
     MSEPPIAVTL KLDERALPAE EFEHVSARAG LIAERRVKRE EALENFGKPG RDEVAFGSLF        60
     AGIAKRAGWV PHMKLAQLRH DWASIVGDVI ARNTWVGAID NGVLTIHAKS PSWTTQLTFM       120
     LPELREKVLE RLNGLDIRDI RVTGPQAHGP ATRRKQYVRQ NMHYRPQ                     167
//

If you have problems or comments...

PBIL Back to PBIL home page