(data stored in ACNUC30630 zone)

EMBL: CP001606.PE407

CP001606.PE407       Location/Qualifiers
FT   CDS             500785..501942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0424"
FT                   /product="hypothetical protein"
FT                   /note="COG1597 Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47372"
FT                   /protein_id="ACS47372.1"
FT                   /translation="MGDNQWVLILVCMIAAIIVIVGAVVGIRIALHIRRVETIKNERRR
FT                   DAVHYAFVINPSKPTAGETRAFIERFCTNRGIADIMFIETQLDKDGRACALEALEQGAD
FT                   VVIAVGGDGTVRTVASAMGGTNHAMGIIPIGTGNLFARNMNIPVGDLEAAMLIAISHGS
FT                   YKVDIGRLQLLDHPEEDHAHAFLIIAGIGFDAVMIDDTDPKLKKNISWLAYFVAGAKHL
FT                   FAPKYHASVVLTGANGDQHVREDVEFRTFMSGNCGEIPVFSLMPDASFNDGLLDFEVID
FT                   TNGGIIGWMNLFGDVVHQTITRKAQQSPLSVHSTIDQVQGVSAELQLEKPVPAQVDGDM
FT                   LKPTRHIRFSVDHNALIVRAPGQDAEMTGNLQPVRVDASGKPRLR"
     MGDNQWVLIL VCMIAAIIVI VGAVVGIRIA LHIRRVETIK NERRRDAVHY AFVINPSKPT        60
     AGETRAFIER FCTNRGIADI MFIETQLDKD GRACALEALE QGADVVIAVG GDGTVRTVAS       120
     AMGGTNHAMG IIPIGTGNLF ARNMNIPVGD LEAAMLIAIS HGSYKVDIGR LQLLDHPEED       180
     HAHAFLIIAG IGFDAVMIDD TDPKLKKNIS WLAYFVAGAK HLFAPKYHAS VVLTGANGDQ       240
     HVREDVEFRT FMSGNCGEIP VFSLMPDASF NDGLLDFEVI DTNGGIIGWM NLFGDVVHQT       300
     ITRKAQQSPL SVHSTIDQVQ GVSAELQLEK PVPAQVDGDM LKPTRHIRFS VDHNALIVRA       360
     PGQDAEMTGN LQPVRVDASG KPRLR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page