(data stored in ACNUC30630 zone)

EMBL: CP001606.PE409

CP001606.PE409       Location/Qualifiers
FT   CDS             complement(503900..505459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0426"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47374"
FT                   /protein_id="ACS47374.1"
FT                   /translation="MSIVMIALFAGLGIAMEPKWSVKPLSMHLQVTERSTAIKARGITT
FT                   PQEGTYQVRQTRLRLPISGGKTVNAILREPENAPSGRAACVFVHGAGTGKAEEVYADLA
FT                   NALASAGITTLVQDKRLDNYTPLRRDYDSSAEDYLAGLNLLRAQQGVDARKVGLYAESE
FT                   GTWIASVMTHKDRHIAFQVLTSAPVYSGRQQIAMAATEYLNIIGAPGGVVDIIPRLLSL
FT                   NFAPIGLEYADFNTAEYRDTLTMPLLVNYGTIDPAMPIEQGALQLIGDAHAAGNSNVLV
FT                   RYYAANHQMRTGSSLSLPGLPLDKDYTHNLEDWINAIAAGATEDDWLTPDIAGARPYQE
FT                   YAIPENISSGLVSSVWVLVVLIVICLVSWLLTVVFCIGAFVSRKRVEAKTVDDSGHIVV
FT                   HRFTMLSKVLIITNIVLLPICAAGFLGYFAFTAKAALSLTDEATMLSFGWSMLRLGSLV
FT                   LIVMNSWMWVRMFFFYGPGNIDKEYPKTAMRMASGHTATVALLSVSVLCALVLSSFFGL
FT                   IG"
     MSIVMIALFA GLGIAMEPKW SVKPLSMHLQ VTERSTAIKA RGITTPQEGT YQVRQTRLRL        60
     PISGGKTVNA ILREPENAPS GRAACVFVHG AGTGKAEEVY ADLANALASA GITTLVQDKR       120
     LDNYTPLRRD YDSSAEDYLA GLNLLRAQQG VDARKVGLYA ESEGTWIASV MTHKDRHIAF       180
     QVLTSAPVYS GRQQIAMAAT EYLNIIGAPG GVVDIIPRLL SLNFAPIGLE YADFNTAEYR       240
     DTLTMPLLVN YGTIDPAMPI EQGALQLIGD AHAAGNSNVL VRYYAANHQM RTGSSLSLPG       300
     LPLDKDYTHN LEDWINAIAA GATEDDWLTP DIAGARPYQE YAIPENISSG LVSSVWVLVV       360
     LIVICLVSWL LTVVFCIGAF VSRKRVEAKT VDDSGHIVVH RFTMLSKVLI ITNIVLLPIC       420
     AAGFLGYFAF TAKAALSLTD EATMLSFGWS MLRLGSLVLI VMNSWMWVRM FFFYGPGNID       480
     KEYPKTAMRM ASGHTATVAL LSVSVLCALV LSSFFGLIG                              519
//

If you have problems or comments...

PBIL Back to PBIL home page