(data stored in ACNUC30630 zone)

EMBL: CP001606.PE413

CP001606.PE413       Location/Qualifiers
FT   CDS             complement(509390..510850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0430"
FT                   /product="histidine kinase sensor of two component system"
FT                   /note="COG1983 Putative stress-responsive transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47378"
FT                   /protein_id="ACS47378.1"
FT                   /translation="MSQIPEHLAPPLLPAKLPLLRPKQGRVIAGVARGISMHLGVSVAL
FT                   VRIVFVLLACWFGVGALAYVALWIAIPEGNPVAEAARLRGTHSSRNAPLARGNASVGES
FT                   ESPLFVSQTLDSAQDAWYAYTGLEQSTDSPSAKDSVRRTLANASKPAIFAGIGVVLIAL
FT                   PSGLNAVMRFSGSQMLPIVPCLAGMGLPWLNTRARNGQAWLTLVGEGLIFTAFLVFVAQ
FT                   TVARNGAVPFGSAIACGFALLVAAICALIPLLMTLIRNIWQERALKEREEERADMTAHL
FT                   HDGVLQTLALIQLHADDEQQVFTLARSQERELRSWLYQERTTSDRSVSAGLQEIAAQVE
FT                   DTHGKPIEVVTVGDARPSAQTDALLDAARQAMVNAVTHGGEPVSVYCEADRHQVEVFVR
FT                   DHGNGFDIDDIPPERLGIRESIIGRVRRRGGTVEIVSRPDWGTEVRMHMPLEAGFDSSR
FT                   TSDSPTDRPAQSGDPIRPAQSTQSTQST"
     MSQIPEHLAP PLLPAKLPLL RPKQGRVIAG VARGISMHLG VSVALVRIVF VLLACWFGVG        60
     ALAYVALWIA IPEGNPVAEA ARLRGTHSSR NAPLARGNAS VGESESPLFV SQTLDSAQDA       120
     WYAYTGLEQS TDSPSAKDSV RRTLANASKP AIFAGIGVVL IALPSGLNAV MRFSGSQMLP       180
     IVPCLAGMGL PWLNTRARNG QAWLTLVGEG LIFTAFLVFV AQTVARNGAV PFGSAIACGF       240
     ALLVAAICAL IPLLMTLIRN IWQERALKER EEERADMTAH LHDGVLQTLA LIQLHADDEQ       300
     QVFTLARSQE RELRSWLYQE RTTSDRSVSA GLQEIAAQVE DTHGKPIEVV TVGDARPSAQ       360
     TDALLDAARQ AMVNAVTHGG EPVSVYCEAD RHQVEVFVRD HGNGFDIDDI PPERLGIRES       420
     IIGRVRRRGG TVEIVSRPDW GTEVRMHMPL EAGFDSSRTS DSPTDRPAQS GDPIRPAQST       480
     QSTQST                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page