(data stored in ACNUC30630 zone)

EMBL: CP001606.PE424

CP001606.PE424       Location/Qualifiers
FT   CDS             523160..525283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0442"
FT                   /product="hypothetical protein"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47389"
FT                   /protein_id="ACS47389.1"
FT                   /translation="MSDKTKSKSGAIVKGAKGSTGNLTTIALIMMNVTVIAGLANDVQQ
FT                   SFYGLSSVTFFLLGGLLFFLPTGLVAAELASGWSQRGGIFRWVGEGIGVFPAVSCLLIL
FT                   WFQTTFTFGSGIPSMSATIGFFTTKYDWAVDFAKNSHTWKVTLPIMIGWLAYYWFCCFL
FT                   ATKGVKTFSKIAQYGVILGTFLPLGVMTILAVVWLCQGHTPAIDMAPSALVPKWEGMST
FT                   LALAAGVFFSFAGIDMNAAHIKDLKKPNKQFPLAIFVSMILALLIFIVGTLIIAMVIPN
FT                   KQINLLYTLFATYRALGATIGFPDLYLVFCWLGMLNSFAALITNLAGPSYMLGQAGRSG
FT                   FLPKFLQNNNKHGMPSRLMYMQMALMTIIAFIVFLLPNVEGFVALITQAITILYLTYYV
FT                   LMFVAFLRLRYQQPNRPRGFKVPGGMFGAWLVAGIGILASVFGIVLAFYPPAQLAAEVG
FT                   SGATYDLIIIGLLAFVFIACVLIYRASRKHDWADPTNQFAPFTWQIEGLKKPSKALSNI
FT                   PTALLSEGQNPMGLPIKKHYDKDEMMKELPTGKDPKQGEVAAALLKKQGITEPSEPAKV
FT                   ALVGDPTVGVKTVSYEPEPVHTNESGDMIPQPTAADVSAAPVPTDAAADARRAEAEAKI
FT                   ASQDAHEYHNEAVALTDEAKDDATLSQDAHHVQVDEAEAHEAQAAVKSIDSINADQAVD
FT                   PTKPEDDPSQPKH"
     MSDKTKSKSG AIVKGAKGST GNLTTIALIM MNVTVIAGLA NDVQQSFYGL SSVTFFLLGG        60
     LLFFLPTGLV AAELASGWSQ RGGIFRWVGE GIGVFPAVSC LLILWFQTTF TFGSGIPSMS       120
     ATIGFFTTKY DWAVDFAKNS HTWKVTLPIM IGWLAYYWFC CFLATKGVKT FSKIAQYGVI       180
     LGTFLPLGVM TILAVVWLCQ GHTPAIDMAP SALVPKWEGM STLALAAGVF FSFAGIDMNA       240
     AHIKDLKKPN KQFPLAIFVS MILALLIFIV GTLIIAMVIP NKQINLLYTL FATYRALGAT       300
     IGFPDLYLVF CWLGMLNSFA ALITNLAGPS YMLGQAGRSG FLPKFLQNNN KHGMPSRLMY       360
     MQMALMTIIA FIVFLLPNVE GFVALITQAI TILYLTYYVL MFVAFLRLRY QQPNRPRGFK       420
     VPGGMFGAWL VAGIGILASV FGIVLAFYPP AQLAAEVGSG ATYDLIIIGL LAFVFIACVL       480
     IYRASRKHDW ADPTNQFAPF TWQIEGLKKP SKALSNIPTA LLSEGQNPMG LPIKKHYDKD       540
     EMMKELPTGK DPKQGEVAAA LLKKQGITEP SEPAKVALVG DPTVGVKTVS YEPEPVHTNE       600
     SGDMIPQPTA ADVSAAPVPT DAAADARRAE AEAKIASQDA HEYHNEAVAL TDEAKDDATL       660
     SQDAHHVQVD EAEAHEAQAA VKSIDSINAD QAVDPTKPED DPSQPKH                     707
//

If you have problems or comments...

PBIL Back to PBIL home page