(data stored in ACNUC30630 zone)

EMBL: CP001606.PE460

CP001606.PE460       Location/Qualifiers
FT   CDS             complement(572431..572826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47425"
FT                   /protein_id="ACS47425.1"
FT                   /translation="MAEDKTSDELTERDIEDLNDPDDNPDVADADATEHNLRRAVIICF
FT                   IVTSVMCLCINIVVLLMLQRKGKLDKAAANLDEFKENMQHLASDKSRQIARNKDVRKAM
FT                   DTISQHIREIPSEAQSAVTRVRDSLAK"
     MAEDKTSDEL TERDIEDLND PDDNPDVADA DATEHNLRRA VIICFIVTSV MCLCINIVVL        60
     LMLQRKGKLD KAAANLDEFK ENMQHLASDK SRQIARNKDV RKAMDTISQH IREIPSEAQS       120
     AVTRVRDSLA K                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page