(data stored in ACNUC30630 zone)

EMBL: CP001606.PE462

CP001606.PE462       Location/Qualifiers
FT   CDS             573560..573733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47427"
FT                   /protein_id="ACS47427.1"
FT                   /translation="MIFHADGITVIRETDSCGVWPKGRAPFRLRVCGLPYGIGIVHECF
FT                   GMGAECVEGGGL"
     MIFHADGITV IRETDSCGVW PKGRAPFRLR VCGLPYGIGI VHECFGMGAE CVEGGGL           57
//

If you have problems or comments...

PBIL Back to PBIL home page