(data stored in ACNUC30630 zone)

EMBL: CP001606.PE473

CP001606.PE473       Location/Qualifiers
FT   CDS             587069..588766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47438"
FT                   /protein_id="ACS47438.1"
FT                   /translation="MEAPRDAQVTPMNRDAGGERPNIVTTMVRLRWSLMFAAMRKSPWQ
FT                   VVGYVLALLMALGIVVGAGLAAFALTGGAVEWNEAAFAVLRVVMVNAGTVGIIFAALIQ
FT                   LLLIGESSTMSAQKFSLFGIGDRTLTAGLYLSAFTGLPATCAFLSLLCASRLYVGYGTG
FT                   AVLGGVLSAALTVMVAMCFSKAALSLASQLTRTERGKNTLYILVTLLVVVAAQLPNIYV
FT                   NTHTEEDFSAIDVNGLVRLTDVVGWLPFGWSLGLPFDAARGNAAACIARVALALVFCAL
FT                   CFAASVWCIRRERLQGEPQSNVRRERSIGAFNWMPDSASGAISARLFISLKRDPRQAMQ
FT                   YVLPVLFIVIFALQSHGESMVVWQCFLWMGLMMLIGESNGIAYDGRAYAMEQIAGVPGR
FT                   VDRWGRTRVYLAYLAIFYVLCALLTYALTGDWRTPAGVMRGITCTVVGFGVVLISLGSA
FT                   EFFSTFLMYPVPSIRKPFSSPQGRAMAQGLFPFAFMLATCVMALPTGIVAIVLAATGHW
FT                   GMNWVLMPVSLANGVLFLWLGVWLGGKILDARGLKVLATLDNFASLQQ"
     MEAPRDAQVT PMNRDAGGER PNIVTTMVRL RWSLMFAAMR KSPWQVVGYV LALLMALGIV        60
     VGAGLAAFAL TGGAVEWNEA AFAVLRVVMV NAGTVGIIFA ALIQLLLIGE SSTMSAQKFS       120
     LFGIGDRTLT AGLYLSAFTG LPATCAFLSL LCASRLYVGY GTGAVLGGVL SAALTVMVAM       180
     CFSKAALSLA SQLTRTERGK NTLYILVTLL VVVAAQLPNI YVNTHTEEDF SAIDVNGLVR       240
     LTDVVGWLPF GWSLGLPFDA ARGNAAACIA RVALALVFCA LCFAASVWCI RRERLQGEPQ       300
     SNVRRERSIG AFNWMPDSAS GAISARLFIS LKRDPRQAMQ YVLPVLFIVI FALQSHGESM       360
     VVWQCFLWMG LMMLIGESNG IAYDGRAYAM EQIAGVPGRV DRWGRTRVYL AYLAIFYVLC       420
     ALLTYALTGD WRTPAGVMRG ITCTVVGFGV VLISLGSAEF FSTFLMYPVP SIRKPFSSPQ       480
     GRAMAQGLFP FAFMLATCVM ALPTGIVAIV LAATGHWGMN WVLMPVSLAN GVLFLWLGVW       540
     LGGKILDARG LKVLATLDNF ASLQQ                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page