(data stored in ACNUC30630 zone)

EMBL: CP001606.PE481

CP001606.PE481       Location/Qualifiers
FT   CDS             complement(596865..598541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0503"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47446"
FT                   /protein_id="ACS47446.1"
FT                   /translation="MAEFIYQMINARKAYGDRVILDNVTLSFLPGAKIGVVGPNGMGKS
FT                   TLLKIMAGLDTVSNGEAQLTPGYTVGILQQEPPLDEDKTVGENIKMAFGDVAAKVARFN
FT                   EIGEEMANPDADFDSLMEEMGKLQTEIDAANGWDLDSQLEQAMDALQCPDPDTPVSVCS
FT                   GGERRRVALCKLLLEAPDLLLLDEPTNHLDAESILWLEKFLHQYPGAVIAVTHDRYFMD
FT                   NVAEWICEVDRGQLYPYKGNYSTYLETKAKRMEIQGAKDAKLAKRLKNELEWVRSSPKA
FT                   RQAKNKARLERYDQMEQEARNSKKLDFSEIQIPPGPRLGSTVLEAEHIHKAFGDRVLID
FT                   DLSFTLPRNGIVGVIGPNGVGKSTLFKTIVGLEPLSGGDLKIGDTVKISYVDQNRAGLD
FT                   PNKNLWEAVSDGNDFIEVGGVEVPTRAYVASFGFKGSDQQKLTGVLSGGERNRLNLALT
FT                   LKQGGNLLLLDEPTNDLDVETLESLENALIEFPGCAVVISHDRWFLDRIATHILAWEGD
FT                   DEHPANWYWFEGNFQAYQENKIARLGEEAARPHRLHRKLTR"
     MAEFIYQMIN ARKAYGDRVI LDNVTLSFLP GAKIGVVGPN GMGKSTLLKI MAGLDTVSNG        60
     EAQLTPGYTV GILQQEPPLD EDKTVGENIK MAFGDVAAKV ARFNEIGEEM ANPDADFDSL       120
     MEEMGKLQTE IDAANGWDLD SQLEQAMDAL QCPDPDTPVS VCSGGERRRV ALCKLLLEAP       180
     DLLLLDEPTN HLDAESILWL EKFLHQYPGA VIAVTHDRYF MDNVAEWICE VDRGQLYPYK       240
     GNYSTYLETK AKRMEIQGAK DAKLAKRLKN ELEWVRSSPK ARQAKNKARL ERYDQMEQEA       300
     RNSKKLDFSE IQIPPGPRLG STVLEAEHIH KAFGDRVLID DLSFTLPRNG IVGVIGPNGV       360
     GKSTLFKTIV GLEPLSGGDL KIGDTVKISY VDQNRAGLDP NKNLWEAVSD GNDFIEVGGV       420
     EVPTRAYVAS FGFKGSDQQK LTGVLSGGER NRLNLALTLK QGGNLLLLDE PTNDLDVETL       480
     ESLENALIEF PGCAVVISHD RWFLDRIATH ILAWEGDDEH PANWYWFEGN FQAYQENKIA       540
     RLGEEAARPH RLHRKLTR                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page