(data stored in ACNUC30630 zone)

EMBL: CP001606.PE482

CP001606.PE482       Location/Qualifiers
FT   CDS             598709..599137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0504"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47447"
FT                   /protein_id="ACS47447.1"
FT                   /translation="MQRTIVTDTSFLSRPSDPADPADPLDAAIAQDLKETLAAHREECV
FT                   GMAANMIGEPKRVIAFVDEGLGSAITVMFNPQITAADGEYDACEGCLSLHGERHTPRFR
FT                   RIEVDYTTRKGRARHATFTDWTAQIIQHEIDHCNGVLI"
     MQRTIVTDTS FLSRPSDPAD PADPLDAAIA QDLKETLAAH REECVGMAAN MIGEPKRVIA        60
     FVDEGLGSAI TVMFNPQITA ADGEYDACEG CLSLHGERHT PRFRRIEVDY TTRKGRARHA       120
     TFTDWTAQII QHEIDHCNGV LI                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page