(data stored in ACNUC30630 zone)

EMBL: CP001606.PE484

CP001606.PE484       Location/Qualifiers
FT   CDS             600743..601375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0506"
FT                   /product="Hypothetical membrane protein"
FT                   /note="COG4721 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47449"
FT                   /protein_id="ACS47449.1"
FT                   /translation="MSTGITQSPRPSSSRFRWTPADIALGAALGVGCGLVFWGFNFAYT
FT                   PISSVLGSILPGIASVLHAVWYFSGTLAVLILRKPGAAVYVNVVGSAVEMLLGNNFAFG
FT                   FVFISAILQGVFAEIPFAATRYRVFNLPMAVLSGLCTALEYGFYLLFFRYQGVALLSPR
FT                   GIVHMISELVGGALIAGVFSWLLFVAVAKTGALDHFASGRAVHVREE"
     MSTGITQSPR PSSSRFRWTP ADIALGAALG VGCGLVFWGF NFAYTPISSV LGSILPGIAS        60
     VLHAVWYFSG TLAVLILRKP GAAVYVNVVG SAVEMLLGNN FAFGFVFISA ILQGVFAEIP       120
     FAATRYRVFN LPMAVLSGLC TALEYGFYLL FFRYQGVALL SPRGIVHMIS ELVGGALIAG       180
     VFSWLLFVAV AKTGALDHFA SGRAVHVREE                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page