(data stored in ACNUC30630 zone)

EMBL: CP001606.PE495

CP001606.PE495       Location/Qualifiers
FT   CDS             614487..616412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0518"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47460"
FT                   /protein_id="ACS47460.1"
FT                   /translation="MTLTMPKLLDDGCVLQSGRPVNIWGWCTPGERVSVRIGECAGETI
FT                   SAADGGWQVRLDALDPGGPYAFEVIGDGATVRRSCYAGEVFLCSGQSNMELSMQWVHPY
FT                   YPSEFQRQDDPLLRQFKVVDRYDFSGPVRDHEEASWLGCAPETLGQFSAVAYFFGRMVR
FT                   QWLHVPVGLLNVSLGGSPIEAWMDAASLDDCPEALEELDPYLGDGVAEARSEESLAAVA
FT                   GWMEELQARRIPADKLHWRHVDLPARFEDCGLPGFQGMLELRRTVVLPPYCEGAEGTLR
FT                   LGAWADIDETYINGINIGGRPNQYEPRDYRIPAGMLHTGANEIVVRLVCNAGSGRVTEG
FT                   KTMTLQVGDEVHDVSGLWRLAVVASMDRPCPSEDFVRWRPTGLYNAMLAPCFRFPVRAA
FT                   LWYQGESNTGTRAAQYGKLLATMIDLWRERWHDPHMPFLIVQLPGISIDCIEDGGWPLV
FT                   RVGQWAVGQQVPDVKTVVTLDAGEPNDLHPHDKKLVASRLFDAACALLYGGDNVQPMVE
FT                   RIEERDGMLCVSYATVARQGANPVPCTPLTLDGGDPGEFEFVWRDAMCAVPAPATVEGA
FT                   EVCIPLPERRPDILRYAWRNNPSRGLLVDGRGTPMPPFAYDLKRGAMIEPSVRAGGDVD
FT                   AGTGRA"
     MTLTMPKLLD DGCVLQSGRP VNIWGWCTPG ERVSVRIGEC AGETISAADG GWQVRLDALD        60
     PGGPYAFEVI GDGATVRRSC YAGEVFLCSG QSNMELSMQW VHPYYPSEFQ RQDDPLLRQF       120
     KVVDRYDFSG PVRDHEEASW LGCAPETLGQ FSAVAYFFGR MVRQWLHVPV GLLNVSLGGS       180
     PIEAWMDAAS LDDCPEALEE LDPYLGDGVA EARSEESLAA VAGWMEELQA RRIPADKLHW       240
     RHVDLPARFE DCGLPGFQGM LELRRTVVLP PYCEGAEGTL RLGAWADIDE TYINGINIGG       300
     RPNQYEPRDY RIPAGMLHTG ANEIVVRLVC NAGSGRVTEG KTMTLQVGDE VHDVSGLWRL       360
     AVVASMDRPC PSEDFVRWRP TGLYNAMLAP CFRFPVRAAL WYQGESNTGT RAAQYGKLLA       420
     TMIDLWRERW HDPHMPFLIV QLPGISIDCI EDGGWPLVRV GQWAVGQQVP DVKTVVTLDA       480
     GEPNDLHPHD KKLVASRLFD AACALLYGGD NVQPMVERIE ERDGMLCVSY ATVARQGANP       540
     VPCTPLTLDG GDPGEFEFVW RDAMCAVPAP ATVEGAEVCI PLPERRPDIL RYAWRNNPSR       600
     GLLVDGRGTP MPPFAYDLKR GAMIEPSVRA GGDVDAGTGR A                           641
//

If you have problems or comments...

PBIL Back to PBIL home page