(data stored in ACNUC30630 zone)

EMBL: CP001606.PE502

CP001606.PE502       Location/Qualifiers
FT   CDS             624133..625047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0525"
FT                   /product="Methylase of polypeptide chain release factor"
FT                   /note="COG2890 Methylase of polypeptide chain release
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47467"
FT                   /protein_id="ACS47467.1"
FT                   /translation="MTTDQLIHRCAEYLREAGVDTPEHDVKLIMADVLGCSPSDVESAA
FT                   IMRTDVRALCAKYGRDDDAELVHTFKHMVCRRHAREPLQYIVGHAPFRYLDLKVGPGVF
FT                   IPRQETELIAQDAIEWVTRHGIYSPRIVDLCAGSGALGLALATEIPGAQVWGVELSPQA
FT                   AVWTRRNITQISRTYPDITANYHLEIADATCPITLAHLDGTVDVVVSNPPYVPQSQVPQ
FT                   QPEVRDFDPSLALYGGSSDGMLIPEQIIRRAYALLRPGGLFLMEHDISQPDRTVAFARA
FT                   SGFSDARTGADLTYRPRYLVATK"
     MTTDQLIHRC AEYLREAGVD TPEHDVKLIM ADVLGCSPSD VESAAIMRTD VRALCAKYGR        60
     DDDAELVHTF KHMVCRRHAR EPLQYIVGHA PFRYLDLKVG PGVFIPRQET ELIAQDAIEW       120
     VTRHGIYSPR IVDLCAGSGA LGLALATEIP GAQVWGVELS PQAAVWTRRN ITQISRTYPD       180
     ITANYHLEIA DATCPITLAH LDGTVDVVVS NPPYVPQSQV PQQPEVRDFD PSLALYGGSS       240
     DGMLIPEQII RRAYALLRPG GLFLMEHDIS QPDRTVAFAR ASGFSDARTG ADLTYRPRYL       300
     VATK                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page