(data stored in ACNUC30630 zone)

EMBL: CP001606.PE509

CP001606.PE509       Location/Qualifiers
FT   CDS             632205..632636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47474"
FT                   /protein_id="ACS47474.1"
FT                   /translation="MKHSAMYIISGIGALVLFVAFLFYTSAPVNLVGWFKLSDLLTIIG
FT                   GLMFIIPFYIVSVRRKMRDNAPNPWAWQYLPVIGMVLMVIGLIFPNGKLTVGVIDLCDV
FT                   LYLFGCVFMLMIFVYPFGSVNEEMLESDVDERVDDDARQ"
     MKHSAMYIIS GIGALVLFVA FLFYTSAPVN LVGWFKLSDL LTIIGGLMFI IPFYIVSVRR        60
     KMRDNAPNPW AWQYLPVIGM VLMVIGLIFP NGKLTVGVID LCDVLYLFGC VFMLMIFVYP       120
     FGSVNEEMLE SDVDERVDDD ARQ                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page