(data stored in ACNUC30630 zone)

EMBL: CP001606.PE511

CP001606.PE511       Location/Qualifiers
FT   CDS             634788..635510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0534"
FT                   /product="hypothetical protein"
FT                   /note="COG0629 Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47476"
FT                   /protein_id="ACS47476.1"
FT                   /translation="MALQQGAVTITGYLGADPQQYGRNPSRPACTFRLGSTRRYQDRNG
FT                   VWQQLPTTWLTVKAFRGLAANIMQSLHRGDPAIVTGLLNTEQWRDEQGVDHSRLVLEAS
FT                   NVGLDLNYVVTMSMRTPREGYTGQQAPSQMASDEQGSPMRPQTQQATSAAPQSTLSRSS
FT                   MAPGDDGGNPVDPFNQMPPDCLSPDAAASMPQQGDQRDAALEPLVGNGMPPQDLEHGCA
FT                   TDTTNSRKEVRPEDQDEF"
     MALQQGAVTI TGYLGADPQQ YGRNPSRPAC TFRLGSTRRY QDRNGVWQQL PTTWLTVKAF        60
     RGLAANIMQS LHRGDPAIVT GLLNTEQWRD EQGVDHSRLV LEASNVGLDL NYVVTMSMRT       120
     PREGYTGQQA PSQMASDEQG SPMRPQTQQA TSAAPQSTLS RSSMAPGDDG GNPVDPFNQM       180
     PPDCLSPDAA ASMPQQGDQR DAALEPLVGN GMPPQDLEHG CATDTTNSRK EVRPEDQDEF       240
//

If you have problems or comments...

PBIL Back to PBIL home page