(data stored in ACNUC30630 zone)

EMBL: CP001606.PE517

CP001606.PE517       Location/Qualifiers
FT   CDS             complement(641631..642614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0540"
FT                   /product="hypothetical protein"
FT                   /note="COG2171 TetrahydrodipicolinateN-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47482"
FT                   /protein_id="ACS47482.1"
FT                   /translation="MTQSRSAWGWGLASIDAAGNVLDVWYPKLTLGEAPAAKPNHGFGN
FT                   LVHEGEDLRGVRRMPVFTVSRLDDPVVDAPDAYLRLHLLSMRLAKPNTLNLDGIFGALN
FT                   NVVWTNYGPFAVDDFAQRRLAVMQGNAGAGMPGMRAEVNVLAIDKFPRMLDYVVPTGVR
FT                   IGDGDRVRLGAYLSEGTTVMHAGFVNFNAGTLGTCMIEGRVSQGVVVGDGSDVGGGASI
FT                   MGTLSGGGKLRNSIGEHSLLGANAGIGISLGDNCVVEAGLYVTAGTKIEVWDKEKAAAG
FT                   VALDVVKGADLSGKNNILFIRNSLTGAIQARPRKTGIALNDALHKN"
     MTQSRSAWGW GLASIDAAGN VLDVWYPKLT LGEAPAAKPN HGFGNLVHEG EDLRGVRRMP        60
     VFTVSRLDDP VVDAPDAYLR LHLLSMRLAK PNTLNLDGIF GALNNVVWTN YGPFAVDDFA       120
     QRRLAVMQGN AGAGMPGMRA EVNVLAIDKF PRMLDYVVPT GVRIGDGDRV RLGAYLSEGT       180
     TVMHAGFVNF NAGTLGTCMI EGRVSQGVVV GDGSDVGGGA SIMGTLSGGG KLRNSIGEHS       240
     LLGANAGIGI SLGDNCVVEA GLYVTAGTKI EVWDKEKAAA GVALDVVKGA DLSGKNNILF       300
     IRNSLTGAIQ ARPRKTGIAL NDALHKN                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page