(data stored in ACNUC30630 zone)

EMBL: CP001606.PE528

CP001606.PE528       Location/Qualifiers
FT   CDS             652755..653609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0551"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47493"
FT                   /protein_id="ACS47493.1"
FT                   /translation="MSEATRKTKSNSDESTATQTPKASVATDIAAAIPAVEAKQVHKAF
FT                   GDLHVLKGIDLTVEPGTVTVILGPSGSGKSTFLRLINQLETITGGEIDVDGEMIGYKKL
FT                   PNGELQTLNDKEIARQRAKLGMVFQKFNLFPHMTALENVMEAPVHVLHMPKAEARKLAI
FT                   KELERVGLGERLDYYPAQLSGGQQQRVAIARALAMKPEIMLFDEPTSALDPELVGEVLN
FT                   VMRSLANDGMTMIVVTHEIGFAKEVADQIVFMDGGVVVERGTPDIIDHPKEERFQDFLQ
FT                   HVL"
     MSEATRKTKS NSDESTATQT PKASVATDIA AAIPAVEAKQ VHKAFGDLHV LKGIDLTVEP        60
     GTVTVILGPS GSGKSTFLRL INQLETITGG EIDVDGEMIG YKKLPNGELQ TLNDKEIARQ       120
     RAKLGMVFQK FNLFPHMTAL ENVMEAPVHV LHMPKAEARK LAIKELERVG LGERLDYYPA       180
     QLSGGQQQRV AIARALAMKP EIMLFDEPTS ALDPELVGEV LNVMRSLAND GMTMIVVTHE       240
     IGFAKEVADQ IVFMDGGVVV ERGTPDIIDH PKEERFQDFL QHVL                        284
//

If you have problems or comments...

PBIL Back to PBIL home page