(data stored in ACNUC30630 zone)

EMBL: CP001606.PE529

CP001606.PE529       Location/Qualifiers
FT   CDS             complement(654084..655019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47494"
FT                   /protein_id="ACS47494.1"
FT                   /translation="MRRNRVVEQLLDSAQHGHRCAYACNRNERVALARRARSGELNQVF
FT                   RNCYVRPDYWDSLRPAERTWHICRTVNQYNPGVVFAGKTAATLLGFPLSHAVHDGTIVC
FT                   AARRNWTSERTQHIYTDMDSAISMQGLLVTNPAHTLVDCALLLPFEETLPMFDSASTTH
FT                   FKQIMEVMGTMSRDVSPVLRLLHFADPRSESGGESKARAVIIVLGFVVPELQISFFDPV
FT                   TRKTYRTDYLWRLADGRAIVGEFDGMEKYVNPQMVGSKTIEQRVLAERERDEALRRCGV
FT                   SQIVHFSYNDVMHPDQLRRKLEQAGVPYVS"
     MRRNRVVEQL LDSAQHGHRC AYACNRNERV ALARRARSGE LNQVFRNCYV RPDYWDSLRP        60
     AERTWHICRT VNQYNPGVVF AGKTAATLLG FPLSHAVHDG TIVCAARRNW TSERTQHIYT       120
     DMDSAISMQG LLVTNPAHTL VDCALLLPFE ETLPMFDSAS TTHFKQIMEV MGTMSRDVSP       180
     VLRLLHFADP RSESGGESKA RAVIIVLGFV VPELQISFFD PVTRKTYRTD YLWRLADGRA       240
     IVGEFDGMEK YVNPQMVGSK TIEQRVLAER ERDEALRRCG VSQIVHFSYN DVMHPDQLRR       300
     KLEQAGVPYV S                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page