(data stored in ACNUC30630 zone)

EMBL: CP001606.PE533

CP001606.PE533       Location/Qualifiers
FT   CDS             660148..660549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47498"
FT                   /protein_id="ACS47498.1"
FT                   /translation="MNAQIWYVVLLSVTVIAALIGTSIVLGQSKNGPGEDHYIDLDPQM
FT                   QGEPYATPVIVGDDGVTRQKDIVHDIKQMPDDTAIVDVLYAGSKKGSKDDTKAEHMTMK
FT                   KVDVRRLGLKPGTTVTLHVVDGAITLIER"
     MNAQIWYVVL LSVTVIAALI GTSIVLGQSK NGPGEDHYID LDPQMQGEPY ATPVIVGDDG        60
     VTRQKDIVHD IKQMPDDTAI VDVLYAGSKK GSKDDTKAEH MTMKKVDVRR LGLKPGTTVT       120
     LHVVDGAITL IER                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page