(data stored in ACNUC30630 zone)

EMBL: CP001606.PE534

CP001606.PE534       Location/Qualifiers
FT   CDS             complement(660556..661314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0557"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COG1521 Putative transcriptional regulator, homolog
FT                   of Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47499"
FT                   /protein_id="ACS47499.1"
FT                   /translation="MILAVDIGNTNIVIGLMEGTETVDTYRITTRSNHTSDEYGLMILQ
FT                   FLQLSNSSPDDVQDAIISSVVPKVMHSFISSMIKFLGIDPMIIGPGIKTGMNIRMDDPR
FT                   SLGADLLADCAGAYTTYGGPVLVIDMGTATTYNYVDEKGAILAGLITTGIGTAAAALAS
FT                   NTAQLPEVQITRPKSILAANTKDAMQAGLYYDCLGGIERTITQFREELDTDFKVVATGG
FT                   MSRIFDCPLIDIVDPTLIFKGMASIYAKNV"
     MILAVDIGNT NIVIGLMEGT ETVDTYRITT RSNHTSDEYG LMILQFLQLS NSSPDDVQDA        60
     IISSVVPKVM HSFISSMIKF LGIDPMIIGP GIKTGMNIRM DDPRSLGADL LADCAGAYTT       120
     YGGPVLVIDM GTATTYNYVD EKGAILAGLI TTGIGTAAAA LASNTAQLPE VQITRPKSIL       180
     AANTKDAMQA GLYYDCLGGI ERTITQFREE LDTDFKVVAT GGMSRIFDCP LIDIVDPTLI       240
     FKGMASIYAK NV                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page