(data stored in ACNUC30630 zone)

EMBL: CP001606.PE538

CP001606.PE538       Location/Qualifiers
FT   CDS             665111..665908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0561"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /note="COG4172 ABC-type uncharacterized transport system,
FT                   duplicated ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47503"
FT                   /protein_id="ACS47503.1"
FT                   /translation="MSVDLQSVNVSIAGRQIVRDVCLQIRDGQRVGLIGSSGSGKSMIA
FT                   RAIMGLLPQDTQLSGSINVNGTQTVGMNDVQLARLRGAAMGMVFQNPAASLNPLLRVRE
FT                   QIELPLKLHYDLPAQDRAERVANMAAKVGLPADVLDRFPHQLSGGQQQRVSIATALITS
FT                   PRLIIADEPTTALDSITQQQILELLVGLVDEAGASMLFVTHDFSVLASATQYCYVLREG
FT                   SIVDAGRTDALLADPADEYTAMLVTAARALSLHVDGSGGANHD"
     MSVDLQSVNV SIAGRQIVRD VCLQIRDGQR VGLIGSSGSG KSMIARAIMG LLPQDTQLSG        60
     SINVNGTQTV GMNDVQLARL RGAAMGMVFQ NPAASLNPLL RVREQIELPL KLHYDLPAQD       120
     RAERVANMAA KVGLPADVLD RFPHQLSGGQ QQRVSIATAL ITSPRLIIAD EPTTALDSIT       180
     QQQILELLVG LVDEAGASML FVTHDFSVLA SATQYCYVLR EGSIVDAGRT DALLADPADE       240
     YTAMLVTAAR ALSLHVDGSG GANHD                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page