(data stored in ACNUC30630 zone)

EMBL: CP001606.PE54

CP001606.PE54        Location/Qualifiers
FT   CDS             complement(59884..60366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0056"
FT                   /product="DNA-binding ferritin-like protein for protection
FT                   from oxidative damage"
FT                   /note="COG0783 DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47019"
FT                   /protein_id="ACS47019.1"
FT                   /translation="MALSFIIPGLDEVASEKIIGILQERLSQEQEAALVLKHAHWNVAG
FT                   PNFIAVHEMLDPQVDEVLAMADETAERIAALGGSPSGRPDDIVRYRTWDKFELEGRQNT
FT                   LDYLRALDKYYDSFIKADRTAIKELDDLDVISSNIVQDHVLKLEQFQWFMRSFLID"
     MALSFIIPGL DEVASEKIIG ILQERLSQEQ EAALVLKHAH WNVAGPNFIA VHEMLDPQVD        60
     EVLAMADETA ERIAALGGSP SGRPDDIVRY RTWDKFELEG RQNTLDYLRA LDKYYDSFIK       120
     ADRTAIKELD DLDVISSNIV QDHVLKLEQF QWFMRSFLID                             160
//

If you have problems or comments...

PBIL Back to PBIL home page