(data stored in ACNUC30630 zone)

EMBL: CP001606.PE546

CP001606.PE546       Location/Qualifiers
FT   CDS             complement(673887..674090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47511"
FT                   /protein_id="ACS47511.1"
FT                   /translation="MREPDSREVLRMALGTVVFAVITVVLTGFQNGWHSLTTVRGVLDV
FT                   LVPTLLWFVGMLIFHLIRHPRM"
     MREPDSREVL RMALGTVVFA VITVVLTGFQ NGWHSLTTVR GVLDVLVPTL LWFVGMLIFH        60
     LIRHPRM                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page