(data stored in ACNUC30630 zone)

EMBL: CP001606.PE556

CP001606.PE556       Location/Qualifiers
FT   CDS             complement(684225..684704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0579"
FT                   /product="hypothetical protein"
FT                   /note="COG1247 Sortase and related acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47521"
FT                   /protein_id="ACS47521.1"
FT                   /translation="MSNLTIRHANAGDIDAIMELLRQVNDVHAHGRPDLFIEGKTKYTP
FT                   TELAQIIADDSRPIFVATDTDSTLLGYAFCMDENHAGANNLQPVRTLYIDDICVDERAR
FT                   GKHVGTELYDHVLDYARAHGYHNVTLNAWAANPAAVKFYESLGMSVYRYGMEQIL"
     MSNLTIRHAN AGDIDAIMEL LRQVNDVHAH GRPDLFIEGK TKYTPTELAQ IIADDSRPIF        60
     VATDTDSTLL GYAFCMDENH AGANNLQPVR TLYIDDICVD ERARGKHVGT ELYDHVLDYA       120
     RAHGYHNVTL NAWAANPAAV KFYESLGMSV YRYGMEQIL                              159
//

If you have problems or comments...

PBIL Back to PBIL home page