(data stored in ACNUC30630 zone)

EMBL: CP001606.PE568

CP001606.PE568       Location/Qualifiers
FT   CDS             complement(697833..700601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0592"
FT                   /product="hypothetical protein"
FT                   /note="COG2898 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47533"
FT                   /protein_id="ACS47533.1"
FT                   /translation="MSATDSNDGVASGQTQAAAKPPTSPKPPKAPKRYAAQPVSNQLLN
FT                   DIRRWIHEQSFALWVTFGFIMINVCWWAWYNIEHHKMPRHALTTSLHEFNVGHLIASLF
FT                   LTGSVFQMIVDALLILLVLCLAEPYLGKSRTAAISLVSAASGTLVGLIICSAISAMLGE
FT                   RAEVLNISFTLSPVVLVIGALMAATAFSYQLWRRRIRIIGYTAIMVVVLYGGNPGDYCV
FT                   LFAAIIGQIIGRAIAGKPIEAEQWHWQYSSSQEIRRIFGAIGVVLALGPMVATSSRSHA
FT                   GPLVSVALVLSPESVNTGVLAACMHGHVVDGCLQQYSLMRASQPGDVVRSVLPLLVMLA
FT                   LAWGMWLGRRTAAISSIVFYAASAFFAISYYLLPYSLDDQLHITMGNIPRMILVNALIP
FT                   LIYAIAVIIELPHFSIRTKPRTLRRCVAAIVIAFVVCSAIYLLFACLRPQDFTPHPNVG
FT                   MVLREWPARFLPIGYLTDSSISFIAVTPLASLVLQGVGIVFWIVLVVVSFAWLNASIDY
FT                   DHKAHALAEELVEDGGESMSFMTTWEGNEYWLSPSKRSAVAYRVLNHIALTTTGPFGDP
FT                   DEWMSDMDEFARYCSDHSWSPVFYAIHEEAKDHLQQLGWHSIVVGDEMLIDPQSWKTTG
FT                   KKWQDIRTAINKAKREGIVDEMSTYDEAPHEVQVQIEEISEQWSEGKALPEMKFTLGGV
FT                   EELKDPRVQVLYAIDSDGIVQAVTSWLPTFNNGRVIGWTLDFMRYRSGSYNGIMEFLIA
FT                   RMAQRMHDQGVADPSNQVQFVSLSAAPLTGLKNFTDAKSDDSSNVDGTTMLQHSLALVA
FT                   DLLEPAYGFKSLYNFKKKFQPIERPVYISYSDSALLANLGIAIIRAYLPALTFRDALGM
FT                   LSSFKPAKPKDDGKATGHGQPAGSPRDAAHESEVHDAKGGKPVDDQAGEPR"
     MSATDSNDGV ASGQTQAAAK PPTSPKPPKA PKRYAAQPVS NQLLNDIRRW IHEQSFALWV        60
     TFGFIMINVC WWAWYNIEHH KMPRHALTTS LHEFNVGHLI ASLFLTGSVF QMIVDALLIL       120
     LVLCLAEPYL GKSRTAAISL VSAASGTLVG LIICSAISAM LGERAEVLNI SFTLSPVVLV       180
     IGALMAATAF SYQLWRRRIR IIGYTAIMVV VLYGGNPGDY CVLFAAIIGQ IIGRAIAGKP       240
     IEAEQWHWQY SSSQEIRRIF GAIGVVLALG PMVATSSRSH AGPLVSVALV LSPESVNTGV       300
     LAACMHGHVV DGCLQQYSLM RASQPGDVVR SVLPLLVMLA LAWGMWLGRR TAAISSIVFY       360
     AASAFFAISY YLLPYSLDDQ LHITMGNIPR MILVNALIPL IYAIAVIIEL PHFSIRTKPR       420
     TLRRCVAAIV IAFVVCSAIY LLFACLRPQD FTPHPNVGMV LREWPARFLP IGYLTDSSIS       480
     FIAVTPLASL VLQGVGIVFW IVLVVVSFAW LNASIDYDHK AHALAEELVE DGGESMSFMT       540
     TWEGNEYWLS PSKRSAVAYR VLNHIALTTT GPFGDPDEWM SDMDEFARYC SDHSWSPVFY       600
     AIHEEAKDHL QQLGWHSIVV GDEMLIDPQS WKTTGKKWQD IRTAINKAKR EGIVDEMSTY       660
     DEAPHEVQVQ IEEISEQWSE GKALPEMKFT LGGVEELKDP RVQVLYAIDS DGIVQAVTSW       720
     LPTFNNGRVI GWTLDFMRYR SGSYNGIMEF LIARMAQRMH DQGVADPSNQ VQFVSLSAAP       780
     LTGLKNFTDA KSDDSSNVDG TTMLQHSLAL VADLLEPAYG FKSLYNFKKK FQPIERPVYI       840
     SYSDSALLAN LGIAIIRAYL PALTFRDALG MLSSFKPAKP KDDGKATGHG QPAGSPRDAA       900
     HESEVHDAKG GKPVDDQAGE PR                                                922
//

If you have problems or comments...

PBIL Back to PBIL home page