(data stored in ACNUC30630 zone)

EMBL: CP001606.PE618

CP001606.PE618       Location/Qualifiers
FT   CDS             complement(757707..760211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0643"
FT                   /product="hypothetical protein"
FT                   /note="COG0392 Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47583"
FT                   /protein_id="ACS47583.1"
FT                   /translation="MTTPNSSGSGRVPSDQTDVQQPSIEKTPEHALASRFPNVKVSDVA
FT                   PKRNHVTSDLLHAGAALVFGILVILVAVYLHGLTTGVEDDAHSASQAFDWLVDLPSSLL
FT                   QQLIVISIVVGVLIQLVLNREWLQSACSVGALLIGFLVCWGVSELLSYHSSAMLINTLL
FT                   SSGTRVGPSLLPDFYAAIAAFLTVAGPRDTRSSVKWSWNILLAGAVIFIMTSWSSLPGV
FT                   LVAICIGRMVGLSIRFGVGTKNSGAWGYQIVQALSSIGLHPAVLDRRPEASDHAPMLTD
FT                   DLTDHSRLYDLTDESGVHYVVSVLDNQVQITGYFSQLWQLIRLNGVAVRHDRSAVSATH
FT                   HHYSMLLGLRDIDLTCARPYGVCDYGESSIVVFEHRETIHAVDCRELDDTEALSLMNYL
FT                   QRAHQRGFTHRQITADTIARSAIGDMVIAGWQNGDYASTTTNITLDKVQLLTLFSTMLG
FT                   IERTVSLARRAWGESTLISLIPFVQKAAVPAATRQMEGWNKQIVEDLRTALSKLAPEEV
FT                   AESMEQVTLTRFNARSFFGLVLLVIAVYVMLTQMRPDEMIRAVKQANLWWAFVVMLFGF
FT                   LAWVGSAMALGAFMDRDRRRPFGLLCSQIAAGFTAVSMPAGIGPAFVNLQYLRKSGYRN
FT                   TTATAIMSAVLAVQGVITVVLLLLIGIFTGRNTLSGMIPTNTLIIAIAVVALAISVIMA
FT                   IPSVRRKIANKYLPLVKSYARSLLETLTQPRKLLGSVAGSLILNLSTGFGFWAALMAFG
FT                   FNMNPIETTFIFLLANTLGSAVPTPGGLGAVEAALSVAFSAVGVPAALALSATLLYRVV
FT                   FYWLRIPLGALAMKWLDKHNLI"
     MTTPNSSGSG RVPSDQTDVQ QPSIEKTPEH ALASRFPNVK VSDVAPKRNH VTSDLLHAGA        60
     ALVFGILVIL VAVYLHGLTT GVEDDAHSAS QAFDWLVDLP SSLLQQLIVI SIVVGVLIQL       120
     VLNREWLQSA CSVGALLIGF LVCWGVSELL SYHSSAMLIN TLLSSGTRVG PSLLPDFYAA       180
     IAAFLTVAGP RDTRSSVKWS WNILLAGAVI FIMTSWSSLP GVLVAICIGR MVGLSIRFGV       240
     GTKNSGAWGY QIVQALSSIG LHPAVLDRRP EASDHAPMLT DDLTDHSRLY DLTDESGVHY       300
     VVSVLDNQVQ ITGYFSQLWQ LIRLNGVAVR HDRSAVSATH HHYSMLLGLR DIDLTCARPY       360
     GVCDYGESSI VVFEHRETIH AVDCRELDDT EALSLMNYLQ RAHQRGFTHR QITADTIARS       420
     AIGDMVIAGW QNGDYASTTT NITLDKVQLL TLFSTMLGIE RTVSLARRAW GESTLISLIP       480
     FVQKAAVPAA TRQMEGWNKQ IVEDLRTALS KLAPEEVAES MEQVTLTRFN ARSFFGLVLL       540
     VIAVYVMLTQ MRPDEMIRAV KQANLWWAFV VMLFGFLAWV GSAMALGAFM DRDRRRPFGL       600
     LCSQIAAGFT AVSMPAGIGP AFVNLQYLRK SGYRNTTATA IMSAVLAVQG VITVVLLLLI       660
     GIFTGRNTLS GMIPTNTLII AIAVVALAIS VIMAIPSVRR KIANKYLPLV KSYARSLLET       720
     LTQPRKLLGS VAGSLILNLS TGFGFWAALM AFGFNMNPIE TTFIFLLANT LGSAVPTPGG       780
     LGAVEAALSV AFSAVGVPAA LALSATLLYR VVFYWLRIPL GALAMKWLDK HNLI             834
//

If you have problems or comments...

PBIL Back to PBIL home page