(data stored in ACNUC30630 zone)

EMBL: CP001606.PE624

CP001606.PE624       Location/Qualifiers
FT   CDS             complement(765371..766432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0649"
FT                   /product="Von Willebrand factor type A-like protein"
FT                   /note="COG2304 Uncharacterized protein containing a
FT                   vonWillebrand factor type A (vWA domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47589"
FT                   /protein_id="ACS47589.1"
FT                   /translation="MMLRWQWPWALVAALLIAALVCLTIVMVSSHRRAYHDEARIYGVQ
FT                   DDLETEHAGALMRVWRRLNRIAVALLACALVLSCILVGRPAHVDAQDEQSSNRDIILCL
FT                   DVSGSTLPYDHQVLSTYLNLLQHFKGERIGLSIFNSSSRTVFPLTDDYAMVTEQLTQAN
FT                   DMLKGVQTQDDIDKMSDEQYQQIADWLEGTQNRKNATSLIGDGLVGCAAMLPGFAYSKA
FT                   DTAQSRSREASIVLATDNVVSGSPTYSLAQALDLTSQAGINVDGLYSGPQSSEGDATTN
FT                   EMRQLIERHGGLFLTQSNSASIDELVREIDGRRSHEAQAQSQTALTDVPGWWTLAVAIL
FT                   LAGWLVMAWRLKR"
     MMLRWQWPWA LVAALLIAAL VCLTIVMVSS HRRAYHDEAR IYGVQDDLET EHAGALMRVW        60
     RRLNRIAVAL LACALVLSCI LVGRPAHVDA QDEQSSNRDI ILCLDVSGST LPYDHQVLST       120
     YLNLLQHFKG ERIGLSIFNS SSRTVFPLTD DYAMVTEQLT QANDMLKGVQ TQDDIDKMSD       180
     EQYQQIADWL EGTQNRKNAT SLIGDGLVGC AAMLPGFAYS KADTAQSRSR EASIVLATDN       240
     VVSGSPTYSL AQALDLTSQA GINVDGLYSG PQSSEGDATT NEMRQLIERH GGLFLTQSNS       300
     ASIDELVREI DGRRSHEAQA QSQTALTDVP GWWTLAVAIL LAGWLVMAWR LKR              353
//

If you have problems or comments...

PBIL Back to PBIL home page