(data stored in ACNUC30630 zone)

EMBL: CP001606.PE646

CP001606.PE646       Location/Qualifiers
FT   CDS             791181..792020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0671"
FT                   /product="ABC-type amino acid transport system periplasmic
FT                   component"
FT                   /note="COG0834 ABC-type amino acid
FT                   transport/signaltransduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47611"
FT                   /protein_id="ACS47611.1"
FT                   /translation="MKHRYKKGLARKAIAMVCAASALFGMAACGSSSADGEKKIRIGIK
FT                   YDQPGLGFKKSGTFEGFDVDVARYVANQLGYTDAEIEFLEAPSKQREAMLQNGDVDMIL
FT                   ATSSITDERKKAVSFAGPYFVAGQDLMVRADDHSINGPEDLNGKRLCSVTGSTSAKVVK
FT                   ERFAKEVQLMEQPGYAECATALFSGIVDAVTTDDIILAGLASASRGKLRVVGKPFTQEY
FT                   YGVGIRKGDTAFAKQINAAIEDMIKSGEWERAIEKNTEGTDYQPDPKYNPPTPDEGE"
     MKHRYKKGLA RKAIAMVCAA SALFGMAACG SSSADGEKKI RIGIKYDQPG LGFKKSGTFE        60
     GFDVDVARYV ANQLGYTDAE IEFLEAPSKQ REAMLQNGDV DMILATSSIT DERKKAVSFA       120
     GPYFVAGQDL MVRADDHSIN GPEDLNGKRL CSVTGSTSAK VVKERFAKEV QLMEQPGYAE       180
     CATALFSGIV DAVTTDDIIL AGLASASRGK LRVVGKPFTQ EYYGVGIRKG DTAFAKQINA       240
     AIEDMIKSGE WERAIEKNTE GTDYQPDPKY NPPTPDEGE                              279
//

If you have problems or comments...

PBIL Back to PBIL home page