(data stored in ACNUC30630 zone)

EMBL: CP001606.PE668

CP001606.PE668       Location/Qualifiers
FT   CDS             complement(816533..818746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47633"
FT                   /protein_id="ACS47633.1"
FT                   /translation="MTHVNTPARRTHPFIAALVAATVIVLVECLVFNFACLRSRSARPA
FT                   DASQSLIEQGSNSAADPQVTLGPGLAIHGDGLLQVTDATKAYIDAPTNGSSPYAQVLMT
FT                   SLNDIALARTTMTQVQRDELYRELVHVRLDGGRMQTVAVDAPRSTYLPYQDSETRHAQS
FT                   NGDHTVRLWIEEATDSLIPIVGLDANARVPFSWNWAQVLLMAAFAALLIAFSPRSRLWL
FT                   IPLDTSSRLQRGAFTIGALALAGYTAVQIYWQIAGAAPMAYHIPGRYSYDYDQYDHVAQ
FT                   ALMNGHAWLDLPVPEQFAQLRNPYDTAARDRLLEQGVTHIYWDYAYHDGHWYSYFGVLP
FT                   ALLLFLPYRAITSLFVPGGLMLPNASADLLLMFGAAVFGCLLVIRLLKRMPVQVSVATC
FT                   ALSCLAFVLGSNLLYFWHRTNFYSIPFASGLFLTFLGMWLWLGAPVARKRTCTLGRSDS
FT                   ADAASLSLLHVALGALCIAATIGCRPTFALTALLAIALFFPQVRAVFSASTWRERATRI
FT                   QALRFLCALIIPAMLIVVPVIAYNAMRFGSFTDFGNAYQITVANMTDFHTPLPQMPRAL
FT                   CCYLFLPLTFGNDFPWLELTPAPTPIWFFTETTPAGLFVLMPLALLAFAVPFMRRPLGR
FT                   LYATLTSMLALSMVLLVFDAYVGGFAWRYLADFSWLVMLCALAVMAWLVERHPAWRVVF
FT                   VIVLVYAIMLALASMFVIGRDDAMINIMPSRFADVRSWFTLLP"
     MTHVNTPARR THPFIAALVA ATVIVLVECL VFNFACLRSR SARPADASQS LIEQGSNSAA        60
     DPQVTLGPGL AIHGDGLLQV TDATKAYIDA PTNGSSPYAQ VLMTSLNDIA LARTTMTQVQ       120
     RDELYRELVH VRLDGGRMQT VAVDAPRSTY LPYQDSETRH AQSNGDHTVR LWIEEATDSL       180
     IPIVGLDANA RVPFSWNWAQ VLLMAAFAAL LIAFSPRSRL WLIPLDTSSR LQRGAFTIGA       240
     LALAGYTAVQ IYWQIAGAAP MAYHIPGRYS YDYDQYDHVA QALMNGHAWL DLPVPEQFAQ       300
     LRNPYDTAAR DRLLEQGVTH IYWDYAYHDG HWYSYFGVLP ALLLFLPYRA ITSLFVPGGL       360
     MLPNASADLL LMFGAAVFGC LLVIRLLKRM PVQVSVATCA LSCLAFVLGS NLLYFWHRTN       420
     FYSIPFASGL FLTFLGMWLW LGAPVARKRT CTLGRSDSAD AASLSLLHVA LGALCIAATI       480
     GCRPTFALTA LLAIALFFPQ VRAVFSASTW RERATRIQAL RFLCALIIPA MLIVVPVIAY       540
     NAMRFGSFTD FGNAYQITVA NMTDFHTPLP QMPRALCCYL FLPLTFGNDF PWLELTPAPT       600
     PIWFFTETTP AGLFVLMPLA LLAFAVPFMR RPLGRLYATL TSMLALSMVL LVFDAYVGGF       660
     AWRYLADFSW LVMLCALAVM AWLVERHPAW RVVFVIVLVY AIMLALASMF VIGRDDAMIN       720
     IMPSRFADVR SWFTLLP                                                      737
//

If you have problems or comments...

PBIL Back to PBIL home page