(data stored in ACNUC30630 zone)

EMBL: CP001606.PE674

CP001606.PE674       Location/Qualifiers
FT   CDS             complement(828742..829488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0699"
FT                   /product="hypothetical protein"
FT                   /note="COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47639"
FT                   /protein_id="ACS47639.1"
FT                   /translation="MFEQIVTIYKFTAAEDKALPWITGAVFAAPIVVGIICGIVFHWGW
FT                   VSWITLMILAVMIGLLLFTIVLTRRADNVGYKQMEGKSGAAISILGNMKRAGFDFPQEP
FT                   VWVDPRTRDAVWRGTGYQGIYLIGEGNYGRVMQAMDRQEKQIKGVTAGSHIPVYRICVG
FT                   DGPKQVRLKDLRNTVLKKKTYVPNNYTNPIMRKLHPRHRFALSKPQLITLNDRLHTLQR
FT                   RSGMGIPKGMDPMKTHKVSRRAIRGR"
     MFEQIVTIYK FTAAEDKALP WITGAVFAAP IVVGIICGIV FHWGWVSWIT LMILAVMIGL        60
     LLFTIVLTRR ADNVGYKQME GKSGAAISIL GNMKRAGFDF PQEPVWVDPR TRDAVWRGTG       120
     YQGIYLIGEG NYGRVMQAMD RQEKQIKGVT AGSHIPVYRI CVGDGPKQVR LKDLRNTVLK       180
     KKTYVPNNYT NPIMRKLHPR HRFALSKPQL ITLNDRLHTL QRRSGMGIPK GMDPMKTHKV       240
     SRRAIRGR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page