(data stored in ACNUC30630 zone)

EMBL: CP001606.PE68

CP001606.PE68        Location/Qualifiers
FT   CDS             complement(74259..77015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0070"
FT                   /product="hypothetical protein"
FT                   /note="COG2352 Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47033"
FT                   /protein_id="ACS47033.1"
FT                   /translation="MTDQEQTITPADATIVSSGLGTKGPEERTLPATLQEDMDLCLNIL
FT                   RQVLSEYDENLLKTFDTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDA
FT                   QLLARAFATYFHLANLCEENYRVAVLHEREAKVDDTQAIDPVNEMTKAYHQLISEMGPA
FT                   KAKELLERLEFHPVFTAHPTEARRKAVEGKIRRIAQLLEAHRLLGGSDKKEDSRRLYSE
FT                   IDALFRTSPIALKKPTPVEEADTILDIFDNTLFHTIPMVYRRFDDWMLGDKAGIEPPAC
FT                   PAFFHPGSWIGSDRDGNPNVTAKVSRQVARKFSDHVLAALEEATRTVGRNMTVESETTP
FT                   PSDELRALWNQQKEISERLTGKASLISTKELHRAVLLVMADRLHYTIKRDTDLMYHNCD
FT                   DFLADLRVVQRSLAEAGDKRAAYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDI
FT                   REHGLHGERGPLQPMTHEVLDTFRALGAIQKRNGVKAARRYIISFTKSAKNVRDVYELN
FT                   RLAFSNPDDAPVIDVIPLFEQLEDLEHSVSVLDEMLKIPEVQARLKQTGRKMEVMLGYS
FT                   DSSKDAGPTTATLALHSAQERIAKWADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPK
FT                   GSVKCRFKLTEQGEVIFARYGNPVLAIRHVESVAAATLLQSAPSVEKTNTEMTEKYKPM
FT                   ANQLSEVSHETFLDLLNSEDFAPWFSIVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTI
FT                   PWIFSWAQARINLAAWYGLGSACESFGDLATLRKAYEEWPLFSTFIDNIEMSLAKTDER
FT                   IAKMYLALGDRPDLSKKVLDEMELTRKWVLKIVGDEWPLQHRHVLGQAIRIRSPYVDAL
FT                   SVTQVLALRSLRKKVDKEELSESQQAGFIYLILCTVSGVAAGLQNTG"
     MTDQEQTITP ADATIVSSGL GTKGPEERTL PATLQEDMDL CLNILRQVLS EYDENLLKTF        60
     DTVRQYAVDA SAERFSGVLT DTHPERDDLE MAVKTIDAMN LHDAQLLARA FATYFHLANL       120
     CEENYRVAVL HEREAKVDDT QAIDPVNEMT KAYHQLISEM GPAKAKELLE RLEFHPVFTA       180
     HPTEARRKAV EGKIRRIAQL LEAHRLLGGS DKKEDSRRLY SEIDALFRTS PIALKKPTPV       240
     EEADTILDIF DNTLFHTIPM VYRRFDDWML GDKAGIEPPA CPAFFHPGSW IGSDRDGNPN       300
     VTAKVSRQVA RKFSDHVLAA LEEATRTVGR NMTVESETTP PSDELRALWN QQKEISERLT       360
     GKASLISTKE LHRAVLLVMA DRLHYTIKRD TDLMYHNCDD FLADLRVVQR SLAEAGDKRA       420
     AYGPLQDLIW QTETFGFHMV EMEFRQHSVV HARALDDIRE HGLHGERGPL QPMTHEVLDT       480
     FRALGAIQKR NGVKAARRYI ISFTKSAKNV RDVYELNRLA FSNPDDAPVI DVIPLFEQLE       540
     DLEHSVSVLD EMLKIPEVQA RLKQTGRKME VMLGYSDSSK DAGPTTATLA LHSAQERIAK       600
     WADENDIDLT LFHGRGGAVG RGGGPANRAV LAQPKGSVKC RFKLTEQGEV IFARYGNPVL       660
     AIRHVESVAA ATLLQSAPSV EKTNTEMTEK YKPMANQLSE VSHETFLDLL NSEDFAPWFS       720
     IVTPLTEIGL LPIGSRPAKR GLGAKSLDDL RTIPWIFSWA QARINLAAWY GLGSACESFG       780
     DLATLRKAYE EWPLFSTFID NIEMSLAKTD ERIAKMYLAL GDRPDLSKKV LDEMELTRKW       840
     VLKIVGDEWP LQHRHVLGQA IRIRSPYVDA LSVTQVLALR SLRKKVDKEE LSESQQAGFI       900
     YLILCTVSGV AAGLQNTG                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page