(data stored in ACNUC30630 zone)

EMBL: CP001606.PE680

CP001606.PE680       Location/Qualifiers
FT   CDS             835342..835584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47645"
FT                   /protein_id="ACS47645.1"
FT                   /translation="MFNIESIKSVVLLANLPVSAPAMLSSVLETFPEQADMLRTHAMTA
FT                   IKDGMLRVLFIHAPLQNGKPNTMHQLWPMFGFPRW"
     MFNIESIKSV VLLANLPVSA PAMLSSVLET FPEQADMLRT HAMTAIKDGM LRVLFIHAPL        60
     QNGKPNTMHQ LWPMFGFPRW                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page