(data stored in ACNUC30630 zone)

EMBL: CP001606.PE687

CP001606.PE687       Location/Qualifiers
FT   CDS             complement(842195..842914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0712"
FT                   /product="ABC transporter"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47652"
FT                   /protein_id="ACS47652.1"
FT                   /translation="MTMHTETETPTTHSAMADGETSVPILQLKDVSYAYAKGGRNVLSD
FT                   INYTFPSGSVTAIVGPSGAGKTTLLSLISGLTTPTGGEVLFEGHNLAKMDRYCYRSRDI
FT                   GVIFQSFNLLPGLTVLENIMLTMDASGKRFDRPKRDIALDLLKQVHLPERYANERILHL
FT                   SGGEQQRVAIARALSTNPQVVIADEPTGNLDPATQDDIMRIFIELAHEQNKCVIIVTHS
FT                   PQIAERSDRVFQLSKRD"
     MTMHTETETP TTHSAMADGE TSVPILQLKD VSYAYAKGGR NVLSDINYTF PSGSVTAIVG        60
     PSGAGKTTLL SLISGLTTPT GGEVLFEGHN LAKMDRYCYR SRDIGVIFQS FNLLPGLTVL       120
     ENIMLTMDAS GKRFDRPKRD IALDLLKQVH LPERYANERI LHLSGGEQQR VAIARALSTN       180
     PQVVIADEPT GNLDPATQDD IMRIFIELAH EQNKCVIIVT HSPQIAERSD RVFQLSKRD        239
//

If you have problems or comments...

PBIL Back to PBIL home page