(data stored in ACNUC30630 zone)

EMBL: CP001606.PE696

CP001606.PE696       Location/Qualifiers
FT   CDS             852666..853622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0721"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COG0548 Acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47661"
FT                   /protein_id="ACS47661.1"
FT                   /translation="MASPLRGPGYHLDVHTDLGPDQKAEVLIEALPWLEEFFGKTIVIK
FT                   YGGNAMVNDHLKECFAEDMVFLRQVGIHPVVVHGGGPQISQMLKALGIHSEFKGGLRVT
FT                   TPEAMDVVRMVLTGKVSRELVGLINAHGPLAVGLSGEDAALFSASQRKPIIDGEPTDIG
FT                   LVGDVVGVDASAVVDLIHAGRIPVVSSVAPNEDDATEVLNVNADSAAAALASALGAHKL
FT                   VILTDVDGLYADWPDKNSLVGRIGVEDLRDLLPELESGMRPKMEACVRAIDGGVQQAHI
FT                   IDGRKPHSILNEIFTTAGVGTMVEPGEGMELRSSYDL"
     MASPLRGPGY HLDVHTDLGP DQKAEVLIEA LPWLEEFFGK TIVIKYGGNA MVNDHLKECF        60
     AEDMVFLRQV GIHPVVVHGG GPQISQMLKA LGIHSEFKGG LRVTTPEAMD VVRMVLTGKV       120
     SRELVGLINA HGPLAVGLSG EDAALFSASQ RKPIIDGEPT DIGLVGDVVG VDASAVVDLI       180
     HAGRIPVVSS VAPNEDDATE VLNVNADSAA AALASALGAH KLVILTDVDG LYADWPDKNS       240
     LVGRIGVEDL RDLLPELESG MRPKMEACVR AIDGGVQQAH IIDGRKPHSI LNEIFTTAGV       300
     GTMVEPGEGM ELRSSYDL                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page