(data stored in ACNUC30630 zone)

EMBL: CP001606.PE70

CP001606.PE70        Location/Qualifiers
FT   CDS             complement(79093..80226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0072"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="COG3464 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47035"
FT                   /protein_id="ACS47035.1"
FT                   /translation="MRSSWLRTLAHVPYGDDAVHLLVRVRRYECVPCSRSWSDDPEAVG
FT                   AGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGMLLLEQADRFSS
FT                   VRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQVLREWMQARGG
FT                   EFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKVRCRLQRDATGR
FT                   RGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDAYQRVIHAYRCD
FT                   DRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRHPRSSNGPTEAI
FT                   NGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
     MRSSWLRTLA HVPYGDDAVH LLVRVRRYEC VPCSRSWSDD PEAVGAGRGV LSVPAVMWAL        60
     RRVCLDSMTV SACARLLHVA WAVVDRAVRE RGMLLLEQAD RFSSVRAIGV DEHVWRHGAF       120
     GDRYVTVIVD LTPRCDGRPA RLLDMVPGRS AQVLREWMQA RGGEFTRRVG VVAMDAFAGW       180
     KQAVESVVPH AVEVIDPFHV VQLAAARVTK VRCRLQRDAT GRRGVKGDRL YDCRRALLTS       240
     DEYLGARGRA RLMALFAIQA NRDLMLAHDA YQRVIHAYRC DDRRRGERMM RELIDDLTGP       300
     GRYKGCRELA SLGRVLKRRM RDILALFRHP RSSNGPTEAI NGRLETLRGN AMGFANTTSY       360
     IQRCLIHSSQ LKDILTH                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page