(data stored in ACNUC30630 zone)

EMBL: CP001606.PE703

CP001606.PE703       Location/Qualifiers
FT   CDS             860327..860914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0728"
FT                   /product="hypothetical protein"
FT                   /note="COG1418 Predicted HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47668"
FT                   /protein_id="ACS47668.1"
FT                   /translation="MPPTYIESDYIGKAHASHMQLAAYAGTYQGEGGGMLDDGGIHAIV
FT                   NAYGADILSHEQMQIERDSLQHGAVTTYEHSIAVACLSVKIADRLHLWHHVNLRSLVRA
FT                   ALLHDYFLYDWHEKDNGSHRLHGFRHPYTAERNARADFELDDIVSNSIRTHMFPLTPIP
FT                   PKYLEGVIVNIADTLCAIRETLSPSRFHAAKP"
     MPPTYIESDY IGKAHASHMQ LAAYAGTYQG EGGGMLDDGG IHAIVNAYGA DILSHEQMQI        60
     ERDSLQHGAV TTYEHSIAVA CLSVKIADRL HLWHHVNLRS LVRAALLHDY FLYDWHEKDN       120
     GSHRLHGFRH PYTAERNARA DFELDDIVSN SIRTHMFPLT PIPPKYLEGV IVNIADTLCA       180
     IRETLSPSRF HAAKP                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page