(data stored in ACNUC30630 zone)

EMBL: CP001606.PE706

CP001606.PE706       Location/Qualifiers
FT   CDS             864125..865165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0731"
FT                   /product="hypothetical protein"
FT                   /note="COG0647 Predicted sugar phosphatases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47671"
FT                   /protein_id="ACS47671.1"
FT                   /translation="MTLLKATEAPLSQTYSLALLDLDGVVYRGKDPVAFASESIRQAEH
FT                   LGMTIEYTTNNSSRMQSVVADQLRGFGLDVEPWQVITSSVVAARMVSKHVPQGAKVLVV
FT                   GAEHLQDEVGKAGLTPVQYASDHPTAVIQGWFPQMTWQMLAEASFAVENGAMYFVTNRD
FT                   LTIPREAGIAPGCGSMIQAVINATGVQPIASAGKPESAMYDEARELAAQGDTEPVCKAR
FT                   SLAIGDRLDTDIEAGNRGGYDSLAVLTGVTNPTELMCAPKHLRPTYIVRDLRGLNEAYP
FT                   RIDVDEAGTRATCAQAQASLTHRRLTVNDPNDVNALRAACALTWQAADSGQDVAAFALP
FT                   EFSLGE"
     MTLLKATEAP LSQTYSLALL DLDGVVYRGK DPVAFASESI RQAEHLGMTI EYTTNNSSRM        60
     QSVVADQLRG FGLDVEPWQV ITSSVVAARM VSKHVPQGAK VLVVGAEHLQ DEVGKAGLTP       120
     VQYASDHPTA VIQGWFPQMT WQMLAEASFA VENGAMYFVT NRDLTIPREA GIAPGCGSMI       180
     QAVINATGVQ PIASAGKPES AMYDEARELA AQGDTEPVCK ARSLAIGDRL DTDIEAGNRG       240
     GYDSLAVLTG VTNPTELMCA PKHLRPTYIV RDLRGLNEAY PRIDVDEAGT RATCAQAQAS       300
     LTHRRLTVND PNDVNALRAA CALTWQAADS GQDVAAFALP EFSLGE                      346
//

If you have problems or comments...

PBIL Back to PBIL home page