(data stored in ACNUC30630 zone)

EMBL: CP001606.PE715

CP001606.PE715       Location/Qualifiers
FT   CDS             875108..875725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47680"
FT                   /protein_id="ACS47680.1"
FT                   /translation="MEWLDEREDGAGGMTEVVSDAPVNPWGLDLDDPFIALRLTAERLS
FT                   LVRYVFVVQIEDGIATAGQRASLEYADAVLIGWPDEHAKGLDAPTDEDRRTIDEQIRLM
FT                   EEYVDKFRTMEQDGDIDGMTDTLIRITERVARVRSIYQPKFLLPTFAEIRRVVQDEWDE
FT                   DMGKIDSDTVMNDNGESGLAKDVQKAALDADEAGRGTDRASE"
     MEWLDEREDG AGGMTEVVSD APVNPWGLDL DDPFIALRLT AERLSLVRYV FVVQIEDGIA        60
     TAGQRASLEY ADAVLIGWPD EHAKGLDAPT DEDRRTIDEQ IRLMEEYVDK FRTMEQDGDI       120
     DGMTDTLIRI TERVARVRSI YQPKFLLPTF AEIRRVVQDE WDEDMGKIDS DTVMNDNGES       180
     GLAKDVQKAA LDADEAGRGT DRASE                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page