(data stored in ACNUC30630 zone)

EMBL: CP001606.PE718

CP001606.PE718       Location/Qualifiers
FT   CDS             877761..879143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0744"
FT                   /product="bifunctional protein glmU"
FT                   /note="COG1207
FT                   N-acetylglucosamine-1-phosphateuridyltransferase (contains
FT                   nucleotidyltransferase and I-patch acetyltransferase
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47683"
FT                   /protein_id="ACS47683.1"
FT                   /translation="MTLTAAIVLAAGEGTRMRSRKPKVLHEFAGKTFLNRVMDAVGALD
FT                   PETLAVVVRYQAQRVAEAARSYDDAVLIVEQDEIPGTGRAVQCAMEQLGEQGPLSGTVL
FT                   ITASDMPLLDTSTLKQLLDYHRDSGDGATVLTTVLDDPTGYGRIIRDADGNVLKIVEQK
FT                   DGNSSELAVREVNTSVYVFDAAVLEQAIANLNADNAQGEFYLTDALTVARQVSKVGAFA
FT                   APDPLSVEGVNDRVQLASLAKAHNLRVCRQWMLDGVTIVDPQTTWIEDEVEMESDAVIL
FT                   PGCFLQGHTTIAHDAVVGPYTTLIDATVEPEAHVERSRVQESRIGREANIGPWTYLRPG
FT                   NEIGTGSKAGAFVEMKKAHIGDGSKVPHLSYVGDADLGENTNIGGGTITANYDGVHKNH
FT                   THIGSDVHIGAGNLFVAPVNVGDGVTSGAGSVIRHDVPGDAMVYSENTQHVVDNWKPAW
FT                   ER"
     MTLTAAIVLA AGEGTRMRSR KPKVLHEFAG KTFLNRVMDA VGALDPETLA VVVRYQAQRV        60
     AEAARSYDDA VLIVEQDEIP GTGRAVQCAM EQLGEQGPLS GTVLITASDM PLLDTSTLKQ       120
     LLDYHRDSGD GATVLTTVLD DPTGYGRIIR DADGNVLKIV EQKDGNSSEL AVREVNTSVY       180
     VFDAAVLEQA IANLNADNAQ GEFYLTDALT VARQVSKVGA FAAPDPLSVE GVNDRVQLAS       240
     LAKAHNLRVC RQWMLDGVTI VDPQTTWIED EVEMESDAVI LPGCFLQGHT TIAHDAVVGP       300
     YTTLIDATVE PEAHVERSRV QESRIGREAN IGPWTYLRPG NEIGTGSKAG AFVEMKKAHI       360
     GDGSKVPHLS YVGDADLGEN TNIGGGTITA NYDGVHKNHT HIGSDVHIGA GNLFVAPVNV       420
     GDGVTSGAGS VIRHDVPGDA MVYSENTQHV VDNWKPAWER                             460
//

If you have problems or comments...

PBIL Back to PBIL home page