(data stored in ACNUC30630 zone)

EMBL: CP001606.PE725

CP001606.PE725       Location/Qualifiers
FT   CDS             884180..884950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0753"
FT                   /product="solute binding protein of ABC transporter system"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47690"
FT                   /protein_id="ACS47690.1"
FT                   /translation="MSIGVPADEPGVGWYHDGEYSGLSVEVAKYVAKVLGYGDEQLFFH
FT                   SQTPATRLDRLDDGSVDFAMVTFAYDGGKNALEMDHTQTADGTRYEVSGPYLVARNQLL
FT                   VRADDARRLPDVQSLDGRTVCTVAGEYSGEQLHDRHPRIKILQRADYSECSASLLVGQS
FT                   DAIAGPQPILAGLRKDGGTRYLHLQEDSYGTQAFGIAVKADQRKLMELIDTALQQMVDD
FT                   GAWDAQIDAMETELGMHVDLSLNPVTVARSQDDE"
     MSIGVPADEP GVGWYHDGEY SGLSVEVAKY VAKVLGYGDE QLFFHSQTPA TRLDRLDDGS        60
     VDFAMVTFAY DGGKNALEMD HTQTADGTRY EVSGPYLVAR NQLLVRADDA RRLPDVQSLD       120
     GRTVCTVAGE YSGEQLHDRH PRIKILQRAD YSECSASLLV GQSDAIAGPQ PILAGLRKDG       180
     GTRYLHLQED SYGTQAFGIA VKADQRKLME LIDTALQQMV DDGAWDAQID AMETELGMHV       240
     DLSLNPVTVA RSQDDE                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page