(data stored in ACNUC30630 zone)

EMBL: CP001606.PE737

CP001606.PE737       Location/Qualifiers
FT   CDS             complement(897068..898582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0767"
FT                   /product="hypothetical protein"
FT                   /note="COG4213 ABC-type xylose transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47702"
FT                   /protein_id="ACS47702.1"
FT                   /translation="MGKGTSHIIRAFVSLAMAGSLMCATAGCSTDPLTGTATTSPSATT
FT                   AASTGHVALFLPSNSPNLSQNVPLNNWNTLNDSLENALSTGGFSGKSMNRETSGSLASQ
FT                   SDALKRYVQERLNADSKEQYGDPQTEQGATTIVIAPAVRLDRNYGEYSHFITTPNQEPS
FT                   DQDASDTDSDESSSMRQIADSLNKAKNAGMHVVVLGNPIDGFVPNVYVPLVTAADIGRM
FT                   QAQQIVSKLDLDAVSESNPKAIEVLLPNTDPSGKNNSFQAQAFEGIWEVLGPYFRQRKA
FT                   YSPSQRLSFFTTKSDYKDVMFKATKDSQIEDELKSRLETKGRDAAVRIDGILAMNDFTA
FT                   AASIKALKTMGYSGSSMDVNPSITIFDVVGNIAGRKPLNRQRVPDPAQSGDESAQPSQT
FT                   TKTDSKQWPIITGFGAYISDIPNIVNGLQWMTGLVDVHANTGTIAQIALQLNRKEKLSN
FT                   IAELKTSDDYGSEIPTLHMTLLAVSAANLKAALIDPGYISLADADM"
     MGKGTSHIIR AFVSLAMAGS LMCATAGCST DPLTGTATTS PSATTAASTG HVALFLPSNS        60
     PNLSQNVPLN NWNTLNDSLE NALSTGGFSG KSMNRETSGS LASQSDALKR YVQERLNADS       120
     KEQYGDPQTE QGATTIVIAP AVRLDRNYGE YSHFITTPNQ EPSDQDASDT DSDESSSMRQ       180
     IADSLNKAKN AGMHVVVLGN PIDGFVPNVY VPLVTAADIG RMQAQQIVSK LDLDAVSESN       240
     PKAIEVLLPN TDPSGKNNSF QAQAFEGIWE VLGPYFRQRK AYSPSQRLSF FTTKSDYKDV       300
     MFKATKDSQI EDELKSRLET KGRDAAVRID GILAMNDFTA AASIKALKTM GYSGSSMDVN       360
     PSITIFDVVG NIAGRKPLNR QRVPDPAQSG DESAQPSQTT KTDSKQWPII TGFGAYISDI       420
     PNIVNGLQWM TGLVDVHANT GTIAQIALQL NRKEKLSNIA ELKTSDDYGS EIPTLHMTLL       480
     AVSAANLKAA LIDPGYISLA DADM                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page