(data stored in ACNUC30630 zone)

EMBL: CP001606.PE752

CP001606.PE752       Location/Qualifiers
FT   CDS             912812..913582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0782"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /note="COG0107 Imidazoleglycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47717"
FT                   /protein_id="ACS47717.1"
FT                   /translation="MSLAVRVIPCLDVDDGRVVKGVHFENLRDAGDPVELAAEYYRQGA
FT                   DELTFLDVTASSSHRQTMVNVVTRTAEQIFIPLTVGGGVRTPEDVDSLLRCGADKVSVN
FT                   TAAINDPTLISRVAERFGNQVLVLSVDARRERGEQHTQSGFEVTTMGGRKSTGIDALWW
FT                   ARRAEELGAGEVLLNSMDADGTQQGFDLEMIRAMREVVSIPIIASGGAGKAQDFPPAIA
FT                   AGADAVLAASIFHYGKVTIGEVKDELRRAGYAVR"
     MSLAVRVIPC LDVDDGRVVK GVHFENLRDA GDPVELAAEY YRQGADELTF LDVTASSSHR        60
     QTMVNVVTRT AEQIFIPLTV GGGVRTPEDV DSLLRCGADK VSVNTAAIND PTLISRVAER       120
     FGNQVLVLSV DARRERGEQH TQSGFEVTTM GGRKSTGIDA LWWARRAEEL GAGEVLLNSM       180
     DADGTQQGFD LEMIRAMREV VSIPIIASGG AGKAQDFPPA IAAGADAVLA ASIFHYGKVT       240
     IGEVKDELRR AGYAVR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page