(data stored in ACNUC30630 zone)

EMBL: CP001606.PE79

CP001606.PE79        Location/Qualifiers
FT   CDS             90682..91479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0081"
FT                   /product="hypothetical protein"
FT                   /note="COG3879 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47044"
FT                   /protein_id="ACS47044.1"
FT                   /translation="MAKHGARHVRKTSVVGSMAVLVVVALVGYLVVTNLRVNKSATVSN
FT                   DAAELIEHRVQRVDELQSEVNKLGSQIDDYNTLLRNNEMQSGNSEEAGQSTMLPAVTGP
FT                   GVTVTLNDSSMWRSAVDSSGSTADIDKYVVHQQDVEAVVDALWAGGAESMQIMDQRVLP
FT                   TSAVICSGNVLLLQGRKYSPPFTISAIGPVDGMLQSLDDSRAIQIYKQYVDAFGLGYDV
FT                   EVNRSLTFQRTPLVLNPLRYAKAFESGGSNESANGGQTTSATN"
     MAKHGARHVR KTSVVGSMAV LVVVALVGYL VVTNLRVNKS ATVSNDAAEL IEHRVQRVDE        60
     LQSEVNKLGS QIDDYNTLLR NNEMQSGNSE EAGQSTMLPA VTGPGVTVTL NDSSMWRSAV       120
     DSSGSTADID KYVVHQQDVE AVVDALWAGG AESMQIMDQR VLPTSAVICS GNVLLLQGRK       180
     YSPPFTISAI GPVDGMLQSL DDSRAIQIYK QYVDAFGLGY DVEVNRSLTF QRTPLVLNPL       240
     RYAKAFESGG SNESANGGQT TSATN                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page