(data stored in ACNUC30630 zone)

EMBL: CP001606.PE92

CP001606.PE92        Location/Qualifiers
FT   CDS             108714..109052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47057"
FT                   /protein_id="ACS47057.1"
FT                   /translation="MVAQNIIMTVLNVIVLVALLVFGVYAVYNNKPNFELTPAHLYDQQ
FT                   MGQKYGIWVFICVIISWLVTLPGLFGPLSNTWNQILWWVELIFNIATLVFCVLASFYYS
FT                   RLNTRPHD"
     MVAQNIIMTV LNVIVLVALL VFGVYAVYNN KPNFELTPAH LYDQQMGQKY GIWVFICVII        60
     SWLVTLPGLF GPLSNTWNQI LWWVELIFNI ATLVFCVLAS FYYSRLNTRP HD               112
//

If you have problems or comments...

PBIL Back to PBIL home page