(data stored in ACNUC30630 zone)

EMBL: CP001606.PE98

CP001606.PE98        Location/Qualifiers
FT   CDS             complement(116322..118163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0101"
FT                   /product="DO serine protease"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47063"
FT                   /protein_id="ACS47063.1"
FT                   /translation="MADDNNNWPTGTPDQNAGSDEHHTDANIGANTEDLNTAPAAPADE
FT                   QPTSVLTPVSGSATEQGEKNDSTSVDGTRKPEPYRLAPQYGAYAPTSQQETTRIPTPPQ
FT                   QGAPNAQQSGLPYQTQNNPQNMPYGVRVDQNQPNAPQGAPNAQNRNPYGVPTGNPFAPS
FT                   NGTPAGPGNPNGPTQSPFGPGSPQQGQPARTPSNIIVAVVAALVAAAICLGVGYAALTN
FT                   GWVKIPTSSSLSSVSSNNHGSGSATVEGGQAPNWASVSANVSKSVVSIQTVVDQGEAKG
FT                   SGAILDKEGHIVTNNHVVSGAKQIQVTLDNGDIYSAKVVGTDSTTDLAVIKLDNPPKDL
FT                   TPITFANSDSLTPGEPIMAIGNPLGYDGTVTTGIVSALNRPVTVMDEENNNAIVTNAVQ
FT                   IDAAINPGNSGGPTFNAAGQVIGINSSIASTASSTQTAGSIGIGFAIPANLVKRVADEI
FT                   IQNGKVEHVALGVTIQSATVEADGVTRGGAVVKSVVANSPAAKAGVKTGDTIVGFNGLA
FT                   VNNNYSLLGFVRAAAMGSTAKLTVVRDGHTMELNVTFDQAEAAVNGSNRNENQNNQNGQ
FT                   NDQNNNGQNDQNNNDGNSDNNNRNRNNDGLIDPFGMW"
     MADDNNNWPT GTPDQNAGSD EHHTDANIGA NTEDLNTAPA APADEQPTSV LTPVSGSATE        60
     QGEKNDSTSV DGTRKPEPYR LAPQYGAYAP TSQQETTRIP TPPQQGAPNA QQSGLPYQTQ       120
     NNPQNMPYGV RVDQNQPNAP QGAPNAQNRN PYGVPTGNPF APSNGTPAGP GNPNGPTQSP       180
     FGPGSPQQGQ PARTPSNIIV AVVAALVAAA ICLGVGYAAL TNGWVKIPTS SSLSSVSSNN       240
     HGSGSATVEG GQAPNWASVS ANVSKSVVSI QTVVDQGEAK GSGAILDKEG HIVTNNHVVS       300
     GAKQIQVTLD NGDIYSAKVV GTDSTTDLAV IKLDNPPKDL TPITFANSDS LTPGEPIMAI       360
     GNPLGYDGTV TTGIVSALNR PVTVMDEENN NAIVTNAVQI DAAINPGNSG GPTFNAAGQV       420
     IGINSSIAST ASSTQTAGSI GIGFAIPANL VKRVADEIIQ NGKVEHVALG VTIQSATVEA       480
     DGVTRGGAVV KSVVANSPAA KAGVKTGDTI VGFNGLAVNN NYSLLGFVRA AAMGSTAKLT       540
     VVRDGHTMEL NVTFDQAEAA VNGSNRNENQ NNQNGQNDQN NNGQNDQNNN DGNSDNNNRN       600
     RNNDGLIDPF GMW                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page