(data stored in ACNUC30630 zone)

EMBL: CP001606.RECN

CP001606.RECN        Location/Qualifiers
FT   CDS             869634..871364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="Balat_0736"
FT                   /product="DNA repair protein RecN"
FT                   /note="COG0497 ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47676"
FT                   /protein_id="ACS47676.1"
FT                   /translation="MVNMLEELELRDLGPIDSATITPAPSMTAITGETGAGKSMLLNAL
FT                   RMISGGTADASRVASGADQAWAQGIFALGERDPLRAMLAEAGIPVDDDGLFLSRSVPAK
FT                   GRSRSVLCGKSVPRSLLGEVASNLITIHGQTDQLRIASVARQREFIDAYARDDKARESF
FT                   NQSYEKYRSVCERLRRLQTQESSMRQQADYLRDSIARIDHVDPHDGELEELMDQRDRIE
FT                   HAEQITSGVEHALAYLDASQFESAEGAAGVGQLIAGAVQSLRGIHAVGDYEQLAERLES
FT                   AGAEIDDVVFSLSRSLDADGETGNLDSINGRIHDLNELAQRWGPTLADVLQWRDRAKID
FT                   VEDLDASPEQLHSLEQERDRLRDEAIARGRALSKARTDAANALSAQVNRELGQLAMSGA
FT                   KLDIVVTPRNGEGMLDATGIDDIEFLFTPFPGSASLPMGKSASGGELSRLMLALELCAA
FT                   DSSQESDSSQNASAGMTFIFDEVDAGVGGKAAVELGRRLAKLARRNQVIVVTHLPQVAS
FT                   WAERQYVVSKETGKEGTHTTVREVSGGERVREIARMLAGSESKTSLEHARELLHESEIE
FT                   "
     MVNMLEELEL RDLGPIDSAT ITPAPSMTAI TGETGAGKSM LLNALRMISG GTADASRVAS        60
     GADQAWAQGI FALGERDPLR AMLAEAGIPV DDDGLFLSRS VPAKGRSRSV LCGKSVPRSL       120
     LGEVASNLIT IHGQTDQLRI ASVARQREFI DAYARDDKAR ESFNQSYEKY RSVCERLRRL       180
     QTQESSMRQQ ADYLRDSIAR IDHVDPHDGE LEELMDQRDR IEHAEQITSG VEHALAYLDA       240
     SQFESAEGAA GVGQLIAGAV QSLRGIHAVG DYEQLAERLE SAGAEIDDVV FSLSRSLDAD       300
     GETGNLDSIN GRIHDLNELA QRWGPTLADV LQWRDRAKID VEDLDASPEQ LHSLEQERDR       360
     LRDEAIARGR ALSKARTDAA NALSAQVNRE LGQLAMSGAK LDIVVTPRNG EGMLDATGID       420
     DIEFLFTPFP GSASLPMGKS ASGGELSRLM LALELCAADS SQESDSSQNA SAGMTFIFDE       480
     VDAGVGGKAA VELGRRLAKL ARRNQVIVVT HLPQVASWAE RQYVVSKETG KEGTHTTVRE       540
     VSGGERVREI ARMLAGSESK TSLEHARELL HESEIE                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page