(data stored in ACNUC30630 zone)

EMBL: CP001606.RPLS

CP001606.RPLS        Location/Qualifiers
FT   CDS             360820..361185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="Balat_0294"
FT                   /product="50S ribosomal protein L19"
FT                   /note="COG0335 Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47250"
FT                   /protein_id="ACS47250.1"
FT                   /translation="MVNAIEAFDAKHMKPADEIPAFRPGDTVDVNVKIQEGNNSRIQTF
FT                   TGVVIGRQGAGVRETFIVRKISFGTGVERRFPLHSPSIDSIKVVRRGRVRRAKLYYLRN
FT                   LRGKAARIVERRDNSAK"
     MVNAIEAFDA KHMKPADEIP AFRPGDTVDV NVKIQEGNNS RIQTFTGVVI GRQGAGVRET        60
     FIVRKISFGT GVERRFPLHS PSIDSIKVVR RGRVRRAKLY YLRNLRGKAA RIVERRDNSA       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page